PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK30861.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 392aa    MW: 43319.6 Da    PI: 5.0967
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK30861.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.59.3e-16195249357
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                 + k+ rr+ +NRe+ArrsR+RK++++ eLe+ v eL++e ++L k+l++++ +++
  KFK30861.1 195 DAKKSRRMLSNRESARRSRKRKQEQTSELETQVNELKGEHSSLLKQLSSINHKYD 249
                 789*********************************************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.1E-19193257IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.519195250IPR004827Basic-leucine zipper domain
PfamPF001701.6E-14195249IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.12E-12197248No hitNo description
Gene3DG3DSA:1.20.5.1703.8E-13197248No hitNo description
CDDcd147021.31E-17198249No hitNo description
PROSITE patternPS000360200215IPR004827Basic-leucine zipper domain
PfamPF124983.8E-13264359IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002240Biological Processresponse to molecule of oomycetes origin
GO:0009626Biological Processplant-type hypersensitive response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MNSIFSIDDF TDSLWESPPH STKVLTAEEV SQSEPEWTFE RCLEEISSSV SSEPIGNNNN  60
SNNNAIVGVS SAQSLPSVSG QNDFEDDSRF RRDPVIVDSD EYRRLLETEC ATVVALRAGS  120
VKPEDSTSSP ETLLQPAQSS PLAQGEFGVS SSLPAEVKKS GVPMKQVNSG SSREDSDDDD  180
LYEENETTGS LNPEDAKKSR RMLSNRESAR RSRKRKQEQT SELETQVNEL KGEHSSLLKQ  240
LSSINHKYDE AAVGNRILKA DIETLRAKVK MAEETVKRVT GMNPPLLGRS NGHNNNRMPL  300
TGHNRMDSSC IPAFQPQSNL NHMLNPTIGI PAILPPRLNN NFVPPPSVNS QANSQLQRIR  360
NGQNHHVTPS GNPYGWNTEP QNDSAWQKKC VD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1209215RRSRKRK
2209216RRSRKRKQ
3211216SRKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_192173.10.0basic leucine zipper 10
SwissprotO227630.0BZP10_ARATH; Basic leucine zipper 10
TrEMBLA0A087GLV90.0A0A087GLV9_ARAAL; Uncharacterized protein
STRINGAT4G02640.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148711720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02640.11e-180bZIP family protein